Pepcalc Tools¶
Configuration File: pepcalc_tools.json
Tool Type: Local
Tools Count: 1
This page contains all tools defined in the pepcalc_tools.json configuration file.
Available Tools¶
PepCalc_peptide_properties (Type: PepCalcTool)¶
Calculate physicochemical properties for a peptide with optional N-terminal and C-terminal chemic…
PepCalc_peptide_properties tool specification
Tool Information:
Name:
PepCalc_peptide_propertiesType:
PepCalcToolDescription: Calculate physicochemical properties for a peptide with optional N-terminal and C-terminal chemical modifications, using the Pep-Calc.com API. Returns the molecular formula, monoisotopic and average molecular weight, isoelectric point (pI), and 280 nm extinction coefficient (oxidized / reduced cysteine).
Unlike a bare-sequence calculator (e.g. ProtParam_calculate, which only accepts standard amino acids with free termini), this tool models the terminal group, so it covers synthetic / therapeutic peptides. The terminal group changes the formula, mass, and pI: for example seq=ACDEFGHIK with C_term=NH2 (amide) gives pI 6.96 and MW 1017.47, while C_term=OH (free acid) gives pI 5.23 and MW 1018.45.
N_term / C_term are chemical-group strings understood by Pep-Calc: N_term defaults to ‘H’ (free amine; ‘Ac’ for N-terminal acetyl), C_term defaults to ‘OH’ (free acid; ‘NH2’ for C-terminal amide). No API key required.
Parameters:
seq(string) (required) Peptide sequence in single-letter amino acid code (e.g. ‘HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR’ or ‘ACDEFGHIK’).
N_term(string) (optional) N-terminal group as a Pep-Calc chemical string. Default ‘H’ (free amine, unmodified). Use ‘Ac’ for N-terminal acetylation.
C_term(string) (optional) C-terminal group as a Pep-Calc chemical string. Default ‘OH’ (free acid, unmodified). Use ‘NH2’ for C-terminal amidation.Example Usage:
query = { "name": "PepCalc_peptide_properties", "arguments": { "seq": "example_value" } } result = tu.run(query)