Protparam Tools#

Configuration File: protparam_tools.json Tool Type: Local Tools Count: 1

This page contains all tools defined in the protparam_tools.json configuration file.

Available Tools#

ProtParam_calculate (Type: ProtParamTool)#

Calculate physicochemical properties of a protein locally from its amino acid sequence (similar t…

ProtParam_calculate tool specification

Tool Information:

  • Name: ProtParam_calculate

  • Type: ProtParamTool

  • Description: Calculate physicochemical properties of a protein locally from its amino acid sequence (similar to ExPASy ProtParam). Returns molecular weight, isoelectric point (pI), amino acid composition, extinction coefficients at 280 nm, instability index, aliphatic index, and GRAVY (grand average of hydropathicity). stability_classification is a ToolUniverse-derived Guruprasad instability-index heuristic, not a retrieved experimental observation; stability_interpretation reports its metric, value, threshold, exact rule, provenance, and scope. No external API needed.

Parameters:

  • sequence (string) (required) Protein amino acid sequence in single-letter code. Example: ‘MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPS’ (partial TP53). Whitespace, numbers, and FASTA headers are stripped.

Example Usage:

query = {
    "name": "ProtParam_calculate",
    "arguments": {
        "sequence": "example_value"
    }
}
result = tu.run(query)