Protparam Tools

Configuration File: protparam_tools.json Tool Type: Local Tools Count: 1

This page contains all tools defined in the protparam_tools.json configuration file.

Available Tools

ProtParam_calculate (Type: ProtParamTool)

Calculate physicochemical properties of a protein from its amino acid sequence (similar to ExPASy…

ProtParam_calculate tool specification

Tool Information:

  • Name: ProtParam_calculate

  • Type: ProtParamTool

  • Description: Calculate physicochemical properties of a protein from its amino acid sequence (similar to ExPASy ProtParam). Returns molecular weight, isoelectric point (pI), amino acid composition, extinction coefficients at 280 nm, instability index, aliphatic index, and GRAVY (grand average of hydropathicity). No external API needed.

Parameters:

  • sequence (string) (required) Protein amino acid sequence in single-letter code. Example: ‘MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPS’ (partial TP53). Whitespace, numbers, and FASTA headers are stripped.

Example Usage:

query = {
    "name": "ProtParam_calculate",
    "arguments": {
        "sequence": "example_value"
    }
}
result = tu.run(query)