Protparam Tools¶
Configuration File: protparam_tools.json
Tool Type: Local
Tools Count: 1
This page contains all tools defined in the protparam_tools.json configuration file.
Available Tools¶
ProtParam_calculate (Type: ProtParamTool)¶
Calculate physicochemical properties of a protein from its amino acid sequence (similar to ExPASy…
ProtParam_calculate tool specification
Tool Information:
Name:
ProtParam_calculateType:
ProtParamToolDescription: Calculate physicochemical properties of a protein from its amino acid sequence (similar to ExPASy ProtParam). Returns molecular weight, isoelectric point (pI), amino acid composition, extinction coefficients at 280 nm, instability index, aliphatic index, and GRAVY (grand average of hydropathicity). No external API needed.
Parameters:
sequence(string) (required) Protein amino acid sequence in single-letter code. Example: ‘MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPS’ (partial TP53). Whitespace, numbers, and FASTA headers are stripped.
Example Usage:
query = {
"name": "ProtParam_calculate",
"arguments": {
"sequence": "example_value"
}
}
result = tu.run(query)