Esmfold Tools¶
Configuration File: esmfold_tools.json
Tool Type: Local
Tools Count: 1
This page contains all tools defined in the esmfold_tools.json configuration file.
Available Tools¶
ESMFold_predict_structure (Type: ESMFoldTool)¶
Predict protein 3D structure from amino acid sequence using ESMFold (Meta’s ESM-2 language model)…
ESMFold_predict_structure tool specification
Tool Information:
Name:
ESMFold_predict_structureType:
ESMFoldToolDescription: Predict protein 3D structure from amino acid sequence using ESMFold (Meta’s ESM-2 language model). Returns per-residue pLDDT confidence scores (0-1 scale, higher=better) and summary statistics. Also returns the predicted PDB coordinate text. Fast single-sequence prediction (no MSA needed). Best for sequences under 400 residues. No authentication required.
Parameters:
sequence(string) (required) Protein amino acid sequence in single-letter code. Example: ‘MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH’. FASTA headers and whitespace are stripped. Max ~400 residues recommended for fast results.
Example Usage:
query = {
"name": "ESMFold_predict_structure",
"arguments": {
"sequence": "example_value"
}
}
result = tu.run(query)