Esmfold Tools

Configuration File: esmfold_tools.json Tool Type: Local Tools Count: 1

This page contains all tools defined in the esmfold_tools.json configuration file.

Available Tools

ESMFold_predict_structure (Type: ESMFoldTool)

Predict protein 3D structure from amino acid sequence using ESMFold (Meta’s ESM-2 language model)…

ESMFold_predict_structure tool specification

Tool Information:

  • Name: ESMFold_predict_structure

  • Type: ESMFoldTool

  • Description: Predict protein 3D structure from amino acid sequence using ESMFold (Meta’s ESM-2 language model). Returns per-residue pLDDT confidence scores (0-1 scale, higher=better) and summary statistics. Also returns the predicted PDB coordinate text. Fast single-sequence prediction (no MSA needed). Best for sequences under 400 residues. No authentication required.

Parameters:

  • sequence (string) (required) Protein amino acid sequence in single-letter code. Example: ‘MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH’. FASTA headers and whitespace are stripped. Max ~400 residues recommended for fast results.

Example Usage:

query = {
    "name": "ESMFold_predict_structure",
    "arguments": {
        "sequence": "example_value"
    }
}
result = tu.run(query)